PTM Viewer PTM Viewer

AT4G01070.1

Arabidopsis thaliana [ath]

UDP-Glycosyltransferase superfamily protein

6 PTM sites : 4 PTM types

PLAZA: AT4G01070
Gene Family: HOM05D000100
Other Names: GT72B1

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

For each protein all PTMs are highlighted by default in the respective protein sequence (right-hand side). One can adjust a selection of PTMs in the PTM table on the left-hand side. In addition, functional protein domains and sites can be underlined if desired.

In the PTM table per PTM the PTM position and type is indicated, as well as the plain peptide sequence that was identified by mass spectrometry. The respective proteomics study is indicated by a number, providing a link to consult the experimental details. Additional PTM meta-data includes various confidence measures such as peptide score provided by search algorithms, posterior error probability (PEP), precursor mass deviation (in ppm) and modification site probability. The available confidence meta-data can be consulted in the extended PTM table by clicking SHOW CONFIDENCE. However, in the default PTM table, a color-coding of confidence is provided with green indicating high confidence, olive medium confidence, grey low confidence, and no color an unassigned confidence. More details regarding this confidence assignment can be consulted in the tutorial or the Plant PTM Viewer manuscript.

Besides confidence measures, log2 fold changes between two conditions with significance values (P- or Q-values) are shown if provided in the respective publication. Log2 fold changes are colored in heatmap-like gradient (green = induced, red = repressed) and significant values are highlighted in green. To determine significance, we employed the threshold used in the respective publication. For more details on the quantitative measurements we refer to the experimental details and respective publication, as methodologies can differ.

On the bottom of the page one can send the whole protein or a part of the protein (i.e. a functional domain) to PTM Blast. This will display aligned protein sequences that potentially report aligned PTMs.

PTMs



PTM Type

Mod AA

Pos

Peptide

Exp ID

Conf
nta M 1 MEESKTPHVAIIPSPGMGHLIPLVEFAKR80
MEESKTPH99
ph S 159 LDETVSCEFR114
sno C 160 LDETVSCEFR90a
90b
sno C 174 ELTEPLMLPGCVPVAGK90a
90b
ub K 433 GLMEGEEGKGVR168
ph S 461 ALSLVALK114

Sequence

Length: 480

MEESKTPHVAIIPSPGMGHLIPLVEFAKRLVHLHGLTVTFVIAGEGPPSKAQRTVLDSLPSSISSVFLPPVDLTDLSSSTRIESRISLTVTRSNPELRKVFDSFVEGGRLPTALVVDLFGTDAFDVAVEFHVPPYIFYPTTANVLSFFLHLPKLDETVSCEFRELTEPLMLPGCVPVAGKDFLDPAQDRKDDAYKWLLHNTKRYKEAEGILVNTFFELEPNAIKALQEPGLDKPPVYPVGPLVNIGKQEAKQTEESECLKWLDNQPLGSVLYVSFGSGGTLTCEQLNELALGLADSEQRFLWVIRSPSGIANSSYFDSHSQTDPLTFLPPGFLERTKKRGFVIPFWAPQAQVLAHPSTGGFLTHCGWNSTLESVVSGIPLIAWPLYAEQKMNAVLLSEDIRAALRPRAGDDGLVRREEVARVVKGLMEGEEGKGVRNKMKELKEAACRVLKDDGTSTKALSLVALKWKAHKKELEQNGNH

ID PTM Type Color
nta N-terminal Acetylation X
ph Phosphorylation X
sno S-nitrosylation X
ub Ubiquitination X
Multiple types X

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR035595 346 389
Sites
Show Type Position
Site 19
Site 117
Active Site 277
Active Site 346
Active Site 347
Active Site 364
Active Site 368
Active Site 369
Active Site 372
Active Site 386
Active Site 277
Active Site 346
Active Site 347
Active Site 364
Active Site 367
Active Site 368
Active Site 369
Active Site 372
Active Site 386
Active Site 388
Active Site 389

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here